X
Email:
sales@ruixibiotech.com

CRF (human, rat) acetate salt

H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH₂ acetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-808 1mg 272.00
- +
+ Add to cart
R-M-808 5mg 1115.00
- +
+ Add to cart

Product description

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. 


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 86784-80-7
Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH₂
Synonyms Corticoliberin, CRH, Corticorelin, CRF-41, Corticotropin Releasing Factor, human, rat
Molecular Formula  C₂₀₈H₃₄₄N₆₀O₆₃S₂
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product