CRF (human, rat) acetate salt
H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH₂ acetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-808 | 1mg | 272.00 | + Add to cart |
|
R-M-808 | 5mg | 1115.00 | + Add to cart |
|
|
Product description
CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 86784-80-7 |
Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH₂ |
Synonyms | Corticoliberin, CRH, Corticorelin, CRF-41, Corticotropin Releasing Factor, human, rat |
Molecular Formula | C₂₀₈H₃₄₄N₆₀O₆₃S₂ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product